Recombinant Human COPS2 protein, His-SUMO-tagged
Cat.No. : | COPS2-4569H |
Product Overview : | Recombinant Human COPS2 protein(P61201)(1-443aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-443aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 67.6 kDa |
AA Sequence : | MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | COPS2 COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) [ Homo sapiens ] |
Official Symbol | COPS2 |
Synonyms | COPS2; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 signalosome complex subunit 2; ALIEN; CSN2; TRIP15; TRIP-15; alien homolog; signalosome subunit 2; TR-interacting protein 15; JAB1-containing signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; SGN2; |
Gene ID | 9318 |
mRNA Refseq | NM_001143887 |
Protein Refseq | NP_001137359 |
MIM | 604508 |
UniProt ID | P61201 |
◆ Recombinant Proteins | ||
COPS2-3236C | Recombinant Chicken COPS2 | +Inquiry |
COPS2-4570H | Recombinant Human COPS2 protein | +Inquiry |
COPS2-1189R | Recombinant Rat COPS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS2-2283Z | Recombinant Zebrafish COPS2 Protein (1-443 aa), His-tagged | +Inquiry |
COPS2-25H | Recombinant Human COPS2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS2-7359HCL | Recombinant Human COPS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPS2 Products
Required fields are marked with *
My Review for All COPS2 Products
Required fields are marked with *