Recombinant Human COPS2 protein, T7/His-tagged
Cat.No. : | COPS2-24H |
Product Overview : | Recombinant Human COPS2 fused with with a small T7-His Tag (29aa) fusion at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | Sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA |
Purity : | > 90% by SDS-PAGE. |
Applications : | 1. May be used for in vitro COPS2 mediated ubiquitin pathway regulation study in COP9 signalosome complex for early stage of neuronal differentiation by intracellular delivery of this protein with ProFectin Reagent. 2. May be used for protein-protein interaction mapping. 3. May be used as specific substrate protein for kinase, ad ubiquitin (Sumo pathway) related enzyme functional screening assays. 4. Potential early diagnostic biomarker protein for gastric cancer. 5. As immunogen for specific antibody production. |
Storage : | In Liquid. Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Concentration : | 0.5 mg/ml |
Gene Name | COPS2 COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) [ Homo sapiens ] |
Official Symbol | COPS2 |
Synonyms | COPS2; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 signalosome complex subunit 2; ALIEN; CSN2; TRIP15; TRIP-15; alien homolog; signalosome subunit 2; TR-interacting protein 15; JAB1-containing signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; SGN2; |
Gene ID | 9318 |
mRNA Refseq | NM_004236 |
Protein Refseq | NP_004227 |
MIM | 604508 |
UniProt ID | P61201 |
Chromosome Location | 15q21.2 |
Function | protein binding; signal transducer activity; |
◆ Recombinant Proteins | ||
COPS2-971R | Recombinant Rhesus monkey COPS2 Protein, His-tagged | +Inquiry |
COPS2-4570H | Recombinant Human COPS2 protein | +Inquiry |
COPS2-1189R | Recombinant Rat COPS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS2-2276H | Recombinant Human COPS2 Protein (Glu26-Val226), N-His tagged | +Inquiry |
COPS2-1700H | Recombinant Human COPS2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS2-7359HCL | Recombinant Human COPS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPS2 Products
Required fields are marked with *
My Review for All COPS2 Products
Required fields are marked with *
0
Inquiry Basket