Recombinant Human COPS2 protein, T7/His-tagged

Cat.No. : COPS2-24H
Product Overview : Recombinant Human COPS2 fused with with a small T7-His Tag (29aa) fusion at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : Sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
Purity : > 90% by SDS-PAGE.
Applications : 1. May be used for in vitro COPS2 mediated ubiquitin pathway regulation study in COP9 signalosome complex for early stage of neuronal differentiation by intracellular delivery of this protein with ProFectin Reagent.
2. May be used for protein-protein interaction mapping.
3. May be used as specific substrate protein for kinase, ad ubiquitin (Sumo pathway) related enzyme functional screening assays.
4. Potential early diagnostic biomarker protein for gastric cancer.
5. As immunogen for specific antibody production.
Storage : In Liquid. Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Concentration : 0.5 mg/ml
Gene Name COPS2 COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) [ Homo sapiens ]
Official Symbol COPS2
Synonyms COPS2; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 signalosome complex subunit 2; ALIEN; CSN2; TRIP15; TRIP-15; alien homolog; signalosome subunit 2; TR-interacting protein 15; JAB1-containing signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; SGN2;
Gene ID 9318
mRNA Refseq NM_004236
Protein Refseq NP_004227
MIM 604508
UniProt ID P61201
Chromosome Location 15q21.2
Function protein binding; signal transducer activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COPS2 Products

Required fields are marked with *

My Review for All COPS2 Products

Required fields are marked with *

0
cart-icon
0
compare icon