Recombinant Human COPS5, His-tagged
| Cat.No. : | COPS5-29878TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 10-334 of Human JAB1 with N terminal His tag; 325 amino acids, 43kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 10-334 a.a. |
| Description : | The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation ofcyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 104 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDH HYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDG ETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQV GRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPF VAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEY QTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWN KYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLG RGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLM SQVIKDKLFNQINIS |
| Sequence Similarities : | Belongs to the peptidase M67A family. CSN5 subfamily.Contains 1 MPN (JAB/Mov34) domain. |
| Gene Name | COPS5 COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis) [ Homo sapiens ] |
| Official Symbol | COPS5 |
| Synonyms | COPS5; COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis); COP9 (constitutive photomorphogenic, Arabidopsis, homolog) subunit 5; COP9 signalosome complex subunit 5; CSN5; JAB1; MOV 34; SGN5; |
| Gene ID | 10987 |
| mRNA Refseq | NM_006837 |
| Protein Refseq | NP_006828 |
| MIM | 604850 |
| Uniprot ID | Q92905 |
| Chromosome Location | 8q13 |
| Pathway | HIF-1-alpha transcription factor network, organism-specific biosystem; Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; |
| Function | metal ion binding; metallopeptidase activity; peptidase activity; protein binding; transcription coactivator activity; |
| ◆ Recombinant Proteins | ||
| COPS5-40H | Recombinant Human COPS5 protein, His-tagged | +Inquiry |
| COPS5-0865H | Recombinant Human COPS5 Protein (A2-T257), GST tagged | +Inquiry |
| COPS5-973R | Recombinant Rhesus monkey COPS5 Protein, His-tagged | +Inquiry |
| COPS5-643H | Recombinant Human COPS5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| COPS5-1959HF | Recombinant Full Length Human COPS5 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COPS5-7356HCL | Recombinant Human COPS5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COPS5 Products
Required fields are marked with *
My Review for All COPS5 Products
Required fields are marked with *
