Recombinant Human COPS8 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COPS8-5963H |
Product Overview : | COPS8 MS Standard C13 and N15-labeled recombinant protein (NP_937832) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
Molecular Mass : | 23.2 kDa |
AA Sequence : | MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COPS8 COP9 signalosome subunit 8 [ Homo sapiens (human) ] |
Official Symbol | COPS8 |
Synonyms | COPS8; COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis); COP9 signalosome complex subunit 8; COP9; CSN8; MGC1297; SGN8; hCOP9; COP9 homolog; signalosome subunit 8; JAB1-containing signalosome subunit 8; MGC43256; |
Gene ID | 10920 |
mRNA Refseq | NM_198189 |
Protein Refseq | NP_937832 |
MIM | 616011 |
UniProt ID | Q99627 |
◆ Recombinant Proteins | ||
COPS8-26339TH | Recombinant Human COPS8, His-tagged | +Inquiry |
COPS8-1893M | Recombinant Mouse COPS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS8-1192R | Recombinant Rat COPS8 Protein, His (Fc)-Avi-tagged | +Inquiry |
COPS8-3786M | Recombinant Mouse COPS8 Protein | +Inquiry |
COPS8-1970HF | Recombinant Full Length Human COPS8 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPS8-7352HCL | Recombinant Human COPS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COPS8 Products
Required fields are marked with *
My Review for All COPS8 Products
Required fields are marked with *
0
Inquiry Basket