Recombinant Human CORIN Protein, GST-tagged

Cat.No. : CORIN-1722H
Product Overview : Human CORIN partial ORF ( NP_006578, 616 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013]
Molecular Mass : 36.74 kDa
AA Sequence : CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CORIN corin, serine peptidase [ Homo sapiens ]
Official Symbol CORIN
Synonyms CORIN; corin, serine peptidase; corin, serine protease; atrial natriuretic peptide-converting enzyme; ATC2; CRN; Lrp4; PRSC; TMPRSS10; pro-ANP-convertase; pro-ANP-converting enzyme; heart specific serine proteinase; transmembrane protease serine 10; heart-specific serine proteinase ATC2; atrial natriuteric peptide-converting enzyme; MGC119742;
Gene ID 10699
mRNA Refseq NM_006587
Protein Refseq NP_006578
MIM 605236
UniProt ID Q9Y5Q5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CORIN Products

Required fields are marked with *

My Review for All CORIN Products

Required fields are marked with *

0
cart-icon
0
compare icon