Recombinant Human CORIN Protein, GST-tagged
| Cat.No. : | CORIN-1722H |
| Product Overview : | Human CORIN partial ORF ( NP_006578, 616 a.a. - 715 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2013] |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | CKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CORIN corin, serine peptidase [ Homo sapiens ] |
| Official Symbol | CORIN |
| Synonyms | CORIN; corin, serine peptidase; corin, serine protease; atrial natriuretic peptide-converting enzyme; ATC2; CRN; Lrp4; PRSC; TMPRSS10; pro-ANP-convertase; pro-ANP-converting enzyme; heart specific serine proteinase; transmembrane protease serine 10; heart-specific serine proteinase ATC2; atrial natriuteric peptide-converting enzyme; MGC119742; |
| Gene ID | 10699 |
| mRNA Refseq | NM_006587 |
| Protein Refseq | NP_006578 |
| MIM | 605236 |
| UniProt ID | Q9Y5Q5 |
| ◆ Recombinant Proteins | ||
| CORIN-3928H | Recombinant Human CORIN protein(1-110aa), His-tagged | +Inquiry |
| CORIN-2718H | Recombinant Human CORIN Protein, His (Fc)-Avi-tagged | +Inquiry |
| Corin-443M | Recombinant Mouse Corin Protein, His-tagged | +Inquiry |
| CORIN-274HFL | Active Recombinant Full Length Human CORIN Protein, C-Flag-tagged | +Inquiry |
| CORIN-1544R | Recombinant Rat CORIN Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CORIN Products
Required fields are marked with *
My Review for All CORIN Products
Required fields are marked with *
