Recombinant Human COX4I2 Protein, GST-tagged
Cat.No. : | COX4I2-1744H |
Product Overview : | Human COX4I2 full-length ORF ( AAH57779, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 44.55 kDa |
AA Sequence : | MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX4I2 cytochrome c oxidase subunit IV isoform 2 (lung) [ Homo sapiens ] |
Official Symbol | COX4I2 |
Synonyms | COX4I2; cytochrome c oxidase subunit IV isoform 2 (lung); COX4L2, cytochrome c oxidase subunit IV isoform 2; cytochrome c oxidase subunit 4 isoform 2, mitochondrial; COX4 2; COX4B; COXIV 2; cytochrome c oxidase subunit IV like 2; dJ857M17.2; COX IV-2; cytochrome c oxidase subunit IV-like 2; COX4; COX4-2; COX4L2; COXIV-2; |
Gene ID | 84701 |
mRNA Refseq | NM_032609 |
Protein Refseq | NP_115998 |
MIM | 607976 |
UniProt ID | Q96KJ9 |
◆ Recombinant Proteins | ||
COX4I2-1551R | Recombinant Rat COX4I2 Protein | +Inquiry |
COX4I2-1208R | Recombinant Rat COX4I2 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX4I2-2004HF | Recombinant Full Length Human COX4I2 Protein, GST-tagged | +Inquiry |
COX4I2-988R | Recombinant Rhesus monkey COX4I2 Protein, His-tagged | +Inquiry |
COX4I2-813R | Recombinant Rhesus Macaque COX4I2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX4I2-388HCL | Recombinant Human COX4I2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX4I2 Products
Required fields are marked with *
My Review for All COX4I2 Products
Required fields are marked with *
0
Inquiry Basket