Recombinant Human COX6B1 Protein, GST-tagged

Cat.No. : COX6B1-1754H
Product Overview : Human COX6B1 full-length ORF ( AAH01015, 1 a.a. - 86 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq, Jan 2010]
Molecular Mass : 35.20 kDa
AA Sequence : MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX6B1 cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [ Homo sapiens ]
Official Symbol COX6B1
Synonyms COX6B1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); COX6B, cytochrome c oxidase subunit Vib , cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous); cytochrome c oxidase subunit 6B1; COXG; COX VIb-1; COX6B; COXVIb1;
Gene ID 1340
mRNA Refseq NM_001863
Protein Refseq NP_001854
MIM 124089
UniProt ID P14854

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX6B1 Products

Required fields are marked with *

My Review for All COX6B1 Products

Required fields are marked with *

0
cart-icon