Recombinant Human COX6B2 Protein, GST-tagged

Cat.No. : COX6B2-1756H
Product Overview : Human COX6B2 full-length ORF ( NP_653214.2, 1 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : COX6B2 (Cytochrome C Oxidase Subunit 6B2) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and AMPK Enzyme Complex Pathway. GO annotations related to this gene include cytochrome-c oxidase activity. An important paralog of this gene is COX6B1.
Molecular Mass : 36.9 kDa
AA Sequence : MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX6B2 cytochrome c oxidase subunit VIb polypeptide 2 (testis) [ Homo sapiens ]
Official Symbol COX6B2
Synonyms COX6B2; cytochrome c oxidase subunit VIb polypeptide 2 (testis); cytochrome c oxidase subunit 6B2; cancer/testis antigen 59; COXVIB2; CT59; cytochrome c oxidase subunit VIb; testes specific; FLJ32865; COX VIb-2; cytochrome c oxidase subunit VIb, testes specific; cytochrome c oxidase subunit VIb, testes-specific; cytochrome c oxidase subunit VIb, testis-specific isoform; FLJ46422; MGC119094;
Gene ID 125965
mRNA Refseq NM_144613
Protein Refseq NP_653214
UniProt ID Q6YFQ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX6B2 Products

Required fields are marked with *

My Review for All COX6B2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon