Recombinant Human COX7A1 Protein, GST-tagged
Cat.No. : | COX7A1-1759H |
Product Overview : | Human COX7A1 full-length ORF ( AAH02757, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (muscle isoform) of subunit VIIa and the polypeptide 1 is present only in muscle tissues. Other polypeptides of subunit VIIa are present in both muscle and nonmuscle tissues, and are encoded by different genes. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34.43 kDa |
AA Sequence : | MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLCLGGTVYSLYSLGWASFPRN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX7A1 cytochrome c oxidase subunit 7A1 [ Homo sapiens (human) ] |
Official Symbol | COX7A1 |
Synonyms | COX7A1; cytochrome c oxidase subunit 7A1; Cytochrome C Oxidase Subunit 7A1; Cytochrome C Oxidase Subunit VIIa Polypeptide 1 (Muscle); Cytochrome C Oxidase Subunit VIIa-Muscle 3 4 Cytochrome C Oxidase Subunit VIIa-Heart; Cytochrome C Oxidase Subunit VIIa-H; Cytochrome C Oxidase Subunit VIIa-M; COX7AH; Cytochrome C Oxidase Subunit VIIa Heart/Muscle Isoform; Cytochrome C Oxidase Subunit 7A1, Mitochondrial; COX7AM; COX7A; cytochrome c oxidase subunit 7A1, mitochondrial; cytochrome c oxidase subunit VIIa heart/muscle isoform; cytochrome c oxidase subunit VIIa polypeptide 1 (muscle); cytochrome c oxidase subunit VIIa-H; cytochrome c oxidase subunit VIIa-M; cytochrome c oxidase subunit VIIa-heart; cytochrome c oxidase subunit VIIa-muscle; EC 1.9.3.1 |
Gene ID | 1346 |
mRNA Refseq | NM_001864 |
Protein Refseq | NP_001855 |
MIM | 123995 |
UniProt ID | P24310 |
◆ Recombinant Proteins | ||
COX7A1-3822M | Recombinant Mouse COX7A1 Protein | +Inquiry |
COX7A1-3232T | Recombinant Trachypithecus cristatus COX7A1 protein, His-sumostar-tagged | +Inquiry |
COX7A1-6533S | Recombinant Silvered leaf-monkey COX7A1 protein, His-KSI-tagged | +Inquiry |
COX7A1-1759H | Recombinant Human COX7A1 Protein, GST-tagged | +Inquiry |
COX7A1-7699Z | Recombinant Zebrafish COX7A1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX7A1 Products
Required fields are marked with *
My Review for All COX7A1 Products
Required fields are marked with *
0
Inquiry Basket