Recombinant Human COX7A2L protein, His-tagged
| Cat.No. : | COX7A2L-11501H |
| Product Overview : | Recombinant Human COX7A2L protein(1-114 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-114 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | COX7A2L cytochrome c oxidase subunit VIIa polypeptide 2 like [ Homo sapiens ] |
| Official Symbol | COX7A2L |
| Synonyms | COX7A2L; cytochrome c oxidase subunit VIIa polypeptide 2 like; cytochrome c oxidase subunit 7A-related protein, mitochondrial; COX7AR; COX7RP; EB1; SIG81; COX7a-related protein; estrogen receptor binding CpG island; cytochrome c oxidase subunit VII-related protein; cytochrome c oxidase subunit VIIa-related protein; |
| mRNA Refseq | NM_004718 |
| Protein Refseq | NP_004709 |
| MIM | 605771 |
| UniProt ID | O14548 |
| Gene ID | 9167 |
| ◆ Recombinant Proteins | ||
| COX7A2L-4970C | Recombinant Chicken COX7A2L | +Inquiry |
| COX7A2L-4971C | Recombinant Chicken COX7A2L | +Inquiry |
| COX7A2L-2015HF | Recombinant Full Length Human COX7A2L Protein, GST-tagged | +Inquiry |
| COX7A2L-1761H | Recombinant Human COX7A2L Protein, GST-tagged | +Inquiry |
| COX7A2L-16H | Recombinant Human COX7A2L protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COX7A2L-7325HCL | Recombinant Human COX7A2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX7A2L Products
Required fields are marked with *
My Review for All COX7A2L Products
Required fields are marked with *
