Recombinant Human COX7A2L protein, GST-tagged

Cat.No. : COX7A2L-2717H
Product Overview : Recombinant Human COX7A2L protein(O14548)(1-114aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-114aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 39.6 kDa
AA Sequence : MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name COX7A2L cytochrome c oxidase subunit VIIa polypeptide 2 like [ Homo sapiens ]
Official Symbol COX7A2L
Synonyms COX7A2L; cytochrome c oxidase subunit VIIa polypeptide 2 like; cytochrome c oxidase subunit 7A-related protein, mitochondrial; COX7AR; COX7RP; EB1; SIG81; COX7a-related protein; estrogen receptor binding CpG island; cytochrome c oxidase subunit VII-related protein; cytochrome c oxidase subunit VIIa-related protein;
Gene ID 9167
mRNA Refseq NM_004718
Protein Refseq NP_004709
MIM 605771
UniProt ID O14548

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX7A2L Products

Required fields are marked with *

My Review for All COX7A2L Products

Required fields are marked with *

0
cart-icon