Recombinant Human COX7A2L protein, GST-tagged
Cat.No. : | COX7A2L-2717H |
Product Overview : | Recombinant Human COX7A2L protein(O14548)(1-114aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-114aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | COX7A2L cytochrome c oxidase subunit VIIa polypeptide 2 like [ Homo sapiens ] |
Official Symbol | COX7A2L |
Synonyms | COX7A2L; cytochrome c oxidase subunit VIIa polypeptide 2 like; cytochrome c oxidase subunit 7A-related protein, mitochondrial; COX7AR; COX7RP; EB1; SIG81; COX7a-related protein; estrogen receptor binding CpG island; cytochrome c oxidase subunit VII-related protein; cytochrome c oxidase subunit VIIa-related protein; |
Gene ID | 9167 |
mRNA Refseq | NM_004718 |
Protein Refseq | NP_004709 |
MIM | 605771 |
UniProt ID | O14548 |
◆ Recombinant Proteins | ||
COX7A2L-11501H | Recombinant Human COX7A2L protein, His-tagged | +Inquiry |
COX7A2L-2717H | Recombinant Human COX7A2L protein, GST-tagged | +Inquiry |
COX7A2L-4971C | Recombinant Chicken COX7A2L | +Inquiry |
COX7A2L-2015HF | Recombinant Full Length Human COX7A2L Protein, GST-tagged | +Inquiry |
COX7A2L-820R | Recombinant Rhesus Macaque COX7A2L Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX7A2L-7325HCL | Recombinant Human COX7A2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX7A2L Products
Required fields are marked with *
My Review for All COX7A2L Products
Required fields are marked with *