Recombinant Human COX7A2L Protein, GST-tagged
Cat.No. : | COX7A2L-1761H |
Product Overview : | Human COX7A2L full-length ORF ( AAH05251.1, 1 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein similar to polypeptides 1 and 2 of subunit VIIa in the C-terminal region, and also highly similar to the mouse Sig81 protein sequence. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. It is possible that this gene represents a regulatory subunit of COX and mediates the higher level of energy production in target cells by estrogen. Several transcript variants, some protein-coding and others non-protein coding, have been found for this gene. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 38.17 kDa |
AA Sequence : | MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX7A2L cytochrome c oxidase subunit VIIa polypeptide 2 like [ Homo sapiens ] |
Official Symbol | COX7A2L |
Synonyms | COX7A2L; cytochrome c oxidase subunit VIIa polypeptide 2 like; cytochrome c oxidase subunit 7A-related protein, mitochondrial; COX7AR; COX7RP; EB1; SIG81; COX7a-related protein; estrogen receptor binding CpG island; cytochrome c oxidase subunit VII-related protein; cytochrome c oxidase subunit VIIa-related protein; |
Gene ID | 9167 |
mRNA Refseq | NM_004718 |
Protein Refseq | NP_004709 |
MIM | 605771 |
UniProt ID | O14548 |
◆ Recombinant Proteins | ||
COX7A2L-4971C | Recombinant Chicken COX7A2L | +Inquiry |
COX7A2L-995R | Recombinant Rhesus monkey COX7A2L Protein, His-tagged | +Inquiry |
COX7A2L-2015HF | Recombinant Full Length Human COX7A2L Protein, GST-tagged | +Inquiry |
COX7A2L-820R | Recombinant Rhesus Macaque COX7A2L Protein, His (Fc)-Avi-tagged | +Inquiry |
COX7A2L-1761H | Recombinant Human COX7A2L Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX7A2L-7325HCL | Recombinant Human COX7A2L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX7A2L Products
Required fields are marked with *
My Review for All COX7A2L Products
Required fields are marked with *
0
Inquiry Basket