Recombinant Human CPE protein(301-410 aa), C-His-tagged
Cat.No. : | CPE-2670H |
Product Overview : | Recombinant Human CPE protein(P16870)(301-410 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 301-410 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDY |
Gene Name | CPE carboxypeptidase E [ Homo sapiens ] |
Official Symbol | CPE |
Synonyms | CPE; carboxypeptidase E; carboxypeptidase H; cobalt stimulated chromaffin granule carboxypeptidase; enkephalin convertase; insulin granule associated carboxypeptidase; CPH; prohormone-processing carboxypeptidase; insulin granule-associated carboxypeptidase; cobalt-stimulated chromaffin granule carboxypeptidase; |
Gene ID | 1363 |
mRNA Refseq | NM_001873 |
Protein Refseq | NP_001864 |
MIM | 114855 |
UniProt ID | P16870 |
◆ Recombinant Proteins | ||
CPE-12820Z | Recombinant Zebrafish CPE | +Inquiry |
Cpe-931M | Recombinant Mouse Cpe Protein, MYC/DDK-tagged | +Inquiry |
Cpe-214M | Recombinant Mouse Cpe, His-tagged | +Inquiry |
CPE-418C | Recombinant Cynomolgus CPE Protein, His-tagged | +Inquiry |
CPE-1438H | Recombinant Human CPE protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPE-2656HCL | Recombinant Human CPE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPE Products
Required fields are marked with *
My Review for All CPE Products
Required fields are marked with *