Recombinant Human CPE protein(301-410 aa), C-His-tagged
| Cat.No. : | CPE-2670H |
| Product Overview : | Recombinant Human CPE protein(P16870)(301-410 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 301-410 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | RKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDY |
| Gene Name | CPE carboxypeptidase E [ Homo sapiens ] |
| Official Symbol | CPE |
| Synonyms | CPE; carboxypeptidase E; carboxypeptidase H; cobalt stimulated chromaffin granule carboxypeptidase; enkephalin convertase; insulin granule associated carboxypeptidase; CPH; prohormone-processing carboxypeptidase; insulin granule-associated carboxypeptidase; cobalt-stimulated chromaffin granule carboxypeptidase; |
| Gene ID | 1363 |
| mRNA Refseq | NM_001873 |
| Protein Refseq | NP_001864 |
| MIM | 114855 |
| UniProt ID | P16870 |
| ◆ Recombinant Proteins | ||
| CPE-723H | Active Recombinant Human CPE, His-tagged | +Inquiry |
| CPE-1780H | Recombinant Human CPE Protein, GST-tagged | +Inquiry |
| CPE-166C | Recombinant Cynomolgus Monkey CPE Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cpe-225M | Recombinant Mouse Cpe, C13&N15-labeled | +Inquiry |
| CPE-1001R | Recombinant Rhesus monkey CPE Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| cpe-001C | Active Native C. perfringens Enterotoxin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPE-2656HCL | Recombinant Human CPE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPE Products
Required fields are marked with *
My Review for All CPE Products
Required fields are marked with *
