| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
Arg191~Leu353 |
| Description : |
The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Form : |
Supplied as lyophilized form in PBS, pH7.4, containing 5% sucrose. |
| Molecular Mass : |
The protein has a predicted molecular mass of 21.0kDa. |
| AA Sequence : |
MGHHHHHHSGSEFRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRL |
| Endotoxin : |
<1.0 EU per 1μg (determined by the LAL method). |
| Purity : |
>95%, 23kDa as determined by SDS-PAGE reducing conditions. |
| Applications : |
SDS-PAGE; WB; ELISA; IP. (May be suitable for use in other assays to be determined by the end user.) |
| Stability : |
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
| Storage : |
Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
| Reconstitution : |
Reconstitute in sterile PBS, pH7.2-pH7.4. |