Recombinant Human CPT1A protein, His-tagged

Cat.No. : CPT1A-1185H
Product Overview : Recombinant Human CPT1A protein(NP_001027017.1)(Arg191~Leu353) was expressed in E. coli with a N-terminal His Tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Arg191~Leu353
Description : The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : Supplied as lyophilized form in PBS, pH7.4, containing 5% sucrose.
Molecular Mass : The protein has a predicted molecular mass of 21.0kDa.
AA Sequence : MGHHHHHHSGSEFRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIYLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTIPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRL
Endotoxin : <1.0 EU per 1μg (determined by the LAL method).
Purity : >95%, 23kDa as determined by SDS-PAGE reducing conditions.
Applications : SDS-PAGE; WB; ELISA; IP.
(May be suitable for use in other assays to be determined by the end user.)
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months.
Reconstitution : Reconstitute in sterile PBS, pH7.2-pH7.4.
Gene Name CPT1A carnitine palmitoyltransferase 1A [Homo sapiens (human)]
Official Symbol CPT1A
Synonyms CPT1A, CPT1
Gene ID 1374
mRNA Refseq NM_001031847.3
Protein Refseq NP_001027017.1
MIM 600528
UniProt ID P50416

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CPT1A Products

Required fields are marked with *

My Review for All CPT1A Products

Required fields are marked with *

0
cart-icon
0
compare icon