Recombinant Human CPXM1 protein, GST-tagged
Cat.No. : | CPXM1-6754H |
Product Overview : | Recombinant Human CPXM1 protein(544-734 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 544-734 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | QDTSRRPCHSQDFSVHGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDYWRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPPDLRRRLERLRGQKD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CPXM1 carboxypeptidase X (M14 family), member 1 [ Homo sapiens ] |
Official Symbol | CPXM1 |
Synonyms | CPXM1; carboxypeptidase X (M14 family), member 1; carboxypeptidase X (M14 family) , CPXM; probable carboxypeptidase X1; carboxypeptidase like protein X1; CPX 1; CPX1; metallocarboxypeptidase CPX-1; carboxypeptidase-like protein X1; CPXM; |
Gene ID | 56265 |
mRNA Refseq | NM_001184699 |
Protein Refseq | NP_001171628 |
MIM | 609555 |
UniProt ID | Q96SM3 |
◆ Recombinant Proteins | ||
Cpxm1-2301M | Recombinant Mouse Cpxm1 Protein, Myc/DDK-tagged | +Inquiry |
CPXM1-2243HF | Recombinant Full Length Human CPXM1 Protein, GST-tagged | +Inquiry |
CPXM1-838R | Recombinant Rhesus Macaque CPXM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPXM1-3336H | Recombinant Human CPXM1 Protein, MYC/DDK-tagged | +Inquiry |
CPXM1-2991H | Recombinant Human CPXM1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPXM1-393HCL | Recombinant Human CPXM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPXM1 Products
Required fields are marked with *
My Review for All CPXM1 Products
Required fields are marked with *