Recombinant Human CPXM1 protein, His-tagged
| Cat.No. : | CPXM1-2991H |
| Product Overview : | Recombinant Human CPXM1 protein(544-734 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 544-734 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | QDTSRRPCHSQDFSVHGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDYWRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPPDLRRRLERLRGQKD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CPXM1 carboxypeptidase X (M14 family), member 1 [ Homo sapiens ] |
| Official Symbol | CPXM1 |
| Synonyms | CPXM1; carboxypeptidase X (M14 family), member 1; carboxypeptidase X (M14 family) , CPXM; probable carboxypeptidase X1; carboxypeptidase like protein X1; CPX 1; CPX1; metallocarboxypeptidase CPX-1; carboxypeptidase-like protein X1; CPXM; |
| Gene ID | 56265 |
| mRNA Refseq | NM_001184699 |
| Protein Refseq | NP_001171628 |
| MIM | 609555 |
| UniProt ID | Q96SM3 |
| ◆ Recombinant Proteins | ||
| Cpxm1-2301M | Recombinant Mouse Cpxm1 Protein, Myc/DDK-tagged | +Inquiry |
| CPXM1-3336H | Recombinant Human CPXM1 Protein, MYC/DDK-tagged | +Inquiry |
| CPXM1-1052H | Recombinant Human CPXM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CPXM1-838R | Recombinant Rhesus Macaque CPXM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CPXM1-2991H | Recombinant Human CPXM1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CPXM1-393HCL | Recombinant Human CPXM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPXM1 Products
Required fields are marked with *
My Review for All CPXM1 Products
Required fields are marked with *
