Recombinant Human CRABP1 protein, His-tagged

Cat.No. : CRABP1-11550H
Product Overview : Recombinant Human CRABP1 protein(1-137 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability November 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-137 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTSELANDELILTFGADDVVCTRIYVRE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol CRABP1
Synonyms CRABP1; cellular retinoic acid binding protein 1; cellular retinoic acid binding protein 1 , RBP5; cellular retinoic acid-binding protein 1; CRABP; CRABP I; CRABPI; cellular retinoic acid-binding protein I; RBP5; CRABP-I;
Gene ID 1381
mRNA Refseq NM_004378
Protein Refseq NP_004369
MIM 180230
UniProt ID P29762

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRABP1 Products

Required fields are marked with *

My Review for All CRABP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon