Recombinant Human CRADD Protein
Cat.No. : | CRADD-526H |
Product Overview : | Recombinant Human CRADD was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a protein containing a death domain (DD) motif. This protein recruits caspase 2/ICH1 to the cell death signal transduction complex, which includes tumor necrosis factor receptor 1 (TNFR1A) and RIPK1/RIP kinase, and acts in promoting apoptosis. A mutation in this gene was associated with mental retardation. A related pseudogene is found on chromosome 3. Alternative splicing results in multiple transcript variants. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 23kD |
AA Sequence : | GSHMEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | CRADD CASP2 and RIPK1 domain containing adaptor with death domain [ Homo sapiens ] |
Official Symbol | CRADD |
Synonyms | CRADD; CASP2 and RIPK1 domain containing adaptor with death domain; death domain-containing protein CRADD; RAIDD; RIP associated ICH1/CED3 homologous protein with death domain; death adaptor molecule RAIDD; caspase and RIP adaptor with death domain; RIP-associated protein with a death domain; RIP-associated ICH1/CED3-homologous protein with death domain; MRT34; MGC9163; |
Gene ID | 8738 |
mRNA Refseq | NM_003805 |
Protein Refseq | NP_003796 |
MIM | 603454 |
UniProt ID | P78560 |
◆ Recombinant Proteins | ||
Cradd-2304M | Recombinant Mouse Cradd Protein, Myc/DDK-tagged | +Inquiry |
CRADD-2259H | Recombinant Human CRADD Protein (Met1-Glu199) | +Inquiry |
CRADD-2252HF | Recombinant Full Length Human CRADD Protein, GST-tagged | +Inquiry |
CRADD-2261H | Recombinant Human CRADD Protein (Met1-Leu140), N-His tagged | +Inquiry |
CRADD-1575Z | Recombinant Zebrafish CRADD | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRADD-7294HCL | Recombinant Human CRADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRADD Products
Required fields are marked with *
My Review for All CRADD Products
Required fields are marked with *