Recombinant Human CRB3 protein, His-tagged
Cat.No. : | CRB3-2808H |
Product Overview : | Recombinant Human CRB3 protein(27-100 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 27-100 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQ |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CRB3 crumbs homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | CRB3 |
Synonyms | CRB3; crumbs homolog 3 (Drosophila); crumbs protein homolog 3; MGC17303; |
Gene ID | 92359 |
mRNA Refseq | NM_139161 |
Protein Refseq | NP_631900 |
MIM | 609737 |
UniProt ID | Q9BUF7 |
◆ Recombinant Proteins | ||
CRB3-3882M | Recombinant Mouse CRB3 Protein | +Inquiry |
CRB3-1836H | Recombinant Human CRB3 Protein, GST-tagged | +Inquiry |
CRB3-2808H | Recombinant Human CRB3 protein, His-tagged | +Inquiry |
CRB3-1017R | Recombinant Rhesus monkey CRB3 Protein, His-tagged | +Inquiry |
CRB3-11555H | Recombinant Human CRB3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRB3-394HCL | Recombinant Human CRB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRB3 Products
Required fields are marked with *
My Review for All CRB3 Products
Required fields are marked with *
0
Inquiry Basket