Recombinant Human CREB3 Protein, GST-tagged
Cat.No. : | CREB3-1842H |
Product Overview : | Human CREB3 full-length ORF ( AAH09402.1, 1 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.[provided by RefSeq, Nov 2009] |
Molecular Mass : | 67.8 kDa |
AA Sequence : | MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CREB3 cAMP responsive element binding protein 3 [ Homo sapiens ] |
Official Symbol | CREB3 |
Synonyms | CREB3; cAMP responsive element binding protein 3; cAMP responsive element binding protein 3 (luman); cyclic AMP-responsive element-binding protein 3; Luman; LZIP; CREB-3; basic leucine zipper protein; transcription factor LZIP-alpha; cAMP-responsive element-binding protein 3; cyclic AMP response element (CRE)-binding protein/activating transcription factor 1; LUMAN; MGC15333; MGC19782; |
Gene ID | 10488 |
mRNA Refseq | NM_006368 |
Protein Refseq | NP_006359 |
MIM | 606443 |
UniProt ID | O43889 |
◆ Recombinant Proteins | ||
RFL11908HF | Recombinant Full Length Human Cyclic Amp-Responsive Element-Binding Protein 3(Creb3) Protein, His-Tagged | +Inquiry |
CREB3-2261HF | Recombinant Full Length Human CREB3 Protein, GST-tagged | +Inquiry |
CREB3-1020R | Recombinant Rhesus monkey CREB3 Protein, His-tagged | +Inquiry |
CREB3-1842H | Recombinant Human CREB3 Protein, GST-tagged | +Inquiry |
CREB3-845R | Recombinant Rhesus Macaque CREB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CREB3-396HCL | Recombinant Human CREB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CREB3 Products
Required fields are marked with *
My Review for All CREB3 Products
Required fields are marked with *
0
Inquiry Basket