Recombinant Human CRHBP Protein, GST-tagged

Cat.No. : CRHBP-1865H
Product Overview : Human CRHBP full-length ORF ( AAH18038, 1 a.a. - 322 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Corticotropin-releasing hormone is a potent stimulator of synthesis and secretion of preopiomelanocortin-derived peptides. Although CRH concentrations in the human peripheral circulation are normally low, they increase throughout pregnancy and fall rapidly after parturition. Maternal plasma CRH probably originates from the placenta. Human plasma contains a CRH-binding protein which inactivates CRH and which may prevent inappropriate pituitary-adrenal stimulation in pregnancy. [provided by RefSeq, Jul 2008]
Molecular Mass : 61.16 kDa
AA Sequence : MSPNFKLQCHFILIFLTALRGESRYLELREAADYDPFLLFSANLKRELAGEQPYRRALRCLDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIHYDQVSIDCQGGDFLKVFDGWILKGEKFPSSQDHPLPSAERYIDFCESGLSRRSIRSSQNVAMIFFRVHEPGNGFTLTIKTDPNLFPCNVISQTPNGKFTLVVPHQHRNCSFSIIYPVVIKISDLTLGHVNGLQLKKSSAGCEGIGDFVELLGGTGLDPSKMTPLADLCYPFHGPAQMKVGCDNTVVRMVSSGKHVNRVTFEYRQLEPYELENPNGNSIGEFCLSGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRHBP corticotropin releasing hormone binding protein [ Homo sapiens ]
Official Symbol CRHBP
Synonyms CRHBP; corticotropin releasing hormone binding protein; corticotropin-releasing factor-binding protein; CRF BP; CRFBP; CRH-BP; CRF-binding protein; corticotropin releasing hormone-binding protein; corticotropin-releasing hormone-binding protein; CRF-BP;
Gene ID 1393
mRNA Refseq NM_001882
Protein Refseq NP_001873
MIM 122559
UniProt ID P24387

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRHBP Products

Required fields are marked with *

My Review for All CRHBP Products

Required fields are marked with *

0
cart-icon