Recombinant Human CRHR1 Protein (24-121 aa), GST-tagged

Cat.No. : CRHR1-424H
Product Overview : Recombinant Human CRHR1 Protein (24-121 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 24-121 aa
Description : G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal bryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 37.9 kDa
AA Sequence : SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name CRHR1 corticotropin releasing hormone receptor 1 [ Homo sapiens ]
Official Symbol CRHR1
Synonyms CRHR1; CRHR; CRF R; CRF1; CRF-R; CRFR1; CRF-R1; CRFR-1; CRH-R1; CRHR1L; CRHR1f; CRF-R-1; CRH-R-1; CRH-R1h;
Gene ID 1394
mRNA Refseq NM_001145146
Protein Refseq NP_001138618
MIM 122561
UniProt ID P34998

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRHR1 Products

Required fields are marked with *

My Review for All CRHR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon