Recombinant Human CRHR1 protein
Cat.No. : | CRHR1-185H |
Product Overview : | Recombinant Human CRHR1 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants. Readthrough transcription also exists between this gene and upstream GeneID:401884 (ADP-ribosylation factor 3 pseudogene), and the readthrough transcripts encode isoforms that share similarity with the products of this gene. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 47.7 kDa |
AA Sequence : | MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGV RYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCL RNIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDR LRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIR KRWHRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV |
Applications : | Antibody Production;Functional Study: Recommended usage only, not validated yet.Compound Screening: Recommended usage only, not validated yet. |
Notes : | Best use within three months from the date of receipt of this protein. Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CRHR1 corticotropin releasing hormone receptor 1 [ Homo sapiens ] |
Official Symbol | CRHR1 |
Synonyms | CRHR1; corticotropin releasing hormone receptor 1; CRHR; corticotropin-releasing factor receptor 1; corticotropin releasing factor receptor; CRF R; CRF1; seven transmembrane helix receptor; corticotropin-releasing hormone receptor 1; corticotropin-releasing factor type 1 receptor; corticotropin releasing hormone receptor variant 1e; corticotropin releasing hormone receptor variant 1g; CRF-R; CRFR1; CRF-R1; CRFR-1; CRH-R1; CRHR1L; CRHR1f; CRF-R-1; CRH-R-1; CRH-R1h; |
Gene ID | 1394 |
mRNA Refseq | NM_001145146 |
Protein Refseq | NP_001138618 |
MIM | 122561 |
UniProt ID | P34998 |
Chromosome Location | 17q12-q22 |
Pathway | Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem; Long-term depression, organism-specific biosystem; Long-term depression, conserved biosystem; |
Function | corticotrophin-releasing factor receptor activity; corticotropin-releasing hormone binding; peptide binding; protein binding; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
RFL34398GF | Recombinant Full Length Chicken Corticotropin-Releasing Factor Receptor 1(Crhr1) Protein, His-Tagged | +Inquiry |
CRHR1-184H | Recombinant Human CRHR1 | +Inquiry |
CRHR1-1597R | Recombinant Rat CRHR1 Protein | +Inquiry |
CRHR1-2731H | Recombinant Human CRHR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRHR1-1369H | Recombinant Human CRHR1 Protein (23-121 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRHR1 Products
Required fields are marked with *
My Review for All CRHR1 Products
Required fields are marked with *