Recombinant Human CRIP2 protein, His-SUMO-tagged
Cat.No. : | CRIP2-2733H |
Product Overview : | Recombinant Human CRIP2 protein(P52943)(1-208aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-208aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.5 kDa |
AA Sequence : | MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CRIP2 cysteine-rich protein 2 [ Homo sapiens ] |
Official Symbol | CRIP2 |
Synonyms | CRIP2; cysteine-rich protein 2; CRP2; ESP1; CRP-2; Cystein-rich intestinal protein; CRIP; |
Gene ID | 1397 |
mRNA Refseq | NM_001312 |
Protein Refseq | NP_001303 |
MIM | 601183 |
UniProt ID | P52943 |
◆ Recombinant Proteins | ||
CRIP2-491H | Recombinant Human CRIP2, None tagged | +Inquiry |
CRIP2-1875H | Recombinant Human CRIP2 Protein, GST-tagged | +Inquiry |
CRIP2-2056HF | Recombinant Full Length Human CRIP2 Protein, GST-tagged | +Inquiry |
CRIP2-3325H | Recombinant Human CRIP2 Protein, MYC/DDK-tagged | +Inquiry |
CRIP2-1238H | Recombinant Human CRIP2 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRIP2-002HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
CRIP2-001HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRIP2 Products
Required fields are marked with *
My Review for All CRIP2 Products
Required fields are marked with *
0
Inquiry Basket