Recombinant Human CRIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CRIP2-2769H |
Product Overview : | CRIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001303) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CRIP2 cysteine-rich protein 2 [ Homo sapiens (human) ] |
Official Symbol | CRIP2 |
Synonyms | CRIP2; cysteine-rich protein 2; CRP2; ESP1; CRP-2; Cystein-rich intestinal protein; CRIP; |
Gene ID | 1397 |
mRNA Refseq | NM_001312 |
Protein Refseq | NP_001303 |
MIM | 601183 |
UniProt ID | P52943 |
◆ Recombinant Proteins | ||
CRIP2-1257R | Recombinant Rat CRIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRIP2-1875H | Recombinant Human CRIP2 Protein, GST-tagged | +Inquiry |
CRIP2-8657H | Recombinant Human CRIP2, His-GST tagged | +Inquiry |
CRIP2-2733H | Recombinant Human CRIP2 protein, His-SUMO-tagged | +Inquiry |
CRIP2-2769H | Recombinant Human CRIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRIP2-002HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
CRIP2-001HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRIP2 Products
Required fields are marked with *
My Review for All CRIP2 Products
Required fields are marked with *