Recombinant Human CRISP3 Protein, GST-tagged
| Cat.No. : | CRISP3-1883H |
| Product Overview : | Human CRISP3 full-length ORF (BAG36185.1, 1 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the cysteine-rich secretory protein (CRISP) family within the CRISP, antigen 5 and pathogenesis-related 1 proteins superfamily. The encoded protein has an N-terminal CRISP, antigen 5 and pathogenesis-related 1 proteins domain, a hinge region, and a C-terminal ion channel regulator domain. This protein contains cysteine residues, located in both the N- and C-terminal domains, that form eight disulfide bonds, a distinguishing characteristic of this family. This gene is expressed in the male reproductive tract where it plays a role in sperm function and fertilization, and the female reproductive tract where it plays a role in endometrial receptivity for embryo implantation. This gene is upregulated in certain types of prostate cancer. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016] |
| Molecular Mass : | 53.35 kDa |
| AA Sequence : | MTLFPVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CRISP3 cysteine-rich secretory protein 3 [ Homo sapiens ] |
| Official Symbol | CRISP3 |
| Synonyms | CRISP3; cysteine-rich secretory protein 3; Aeg2; CRISP 3; CRS3; dJ442L6.3; SGP28; cysteine-rich secretory protein-3; specific granule protein (28 kDa); specific granule protein of 28 kDa; CRISP-3; MGC126588; |
| Gene ID | 10321 |
| mRNA Refseq | NM_001190986 |
| Protein Refseq | NP_001177915 |
| UniProt ID | P54108 |
| ◆ Recombinant Proteins | ||
| CRISP3-2064HF | Recombinant Full Length Human CRISP3 Protein, GST-tagged | +Inquiry |
| CRISP3-503H | Active Recombinant Human CRISP3, His-tagged | +Inquiry |
| CRISP3-3911M | Recombinant Mouse CRISP3 Protein | +Inquiry |
| CRISP3-1883H | Recombinant Human CRISP3 Protein, GST-tagged | +Inquiry |
| CRISP3-7822H | Recombinant Human CRISP3, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRISP3-7278HCL | Recombinant Human CRISP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRISP3 Products
Required fields are marked with *
My Review for All CRISP3 Products
Required fields are marked with *



