Recombinant Human CRKL, His-tagged
Cat.No. : | CRKL-26624TH |
Product Overview : | Recombinant full length Human CrkL with an N terminal His tag; 323 amino acids with tag, predicted MWt 35.9 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic. |
Protein length : | 303 amino acids |
Conjugation : | HIS |
Molecular Weight : | 35.900kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.03% DTT, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSSARFDSSDRSAWYMGPVS RQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIE PAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVS GSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEV GDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD ENE |
Sequence Similarities : | Belongs to the CRK family.Contains 1 SH2 domain.Contains 2 SH3 domains. |
Gene Name : | CRKL v-crk sarcoma virus CT10 oncogene homolog (avian)-like [ Homo sapiens ] |
Official Symbol : | CRKL |
Synonyms : | CRKL; v-crk sarcoma virus CT10 oncogene homolog (avian)-like; v crk avian sarcoma virus CT10 oncogene homolog like; crk-like protein; |
Gene ID : | 1399 |
mRNA Refseq : | NM_005207 |
Protein Refseq : | NP_005198 |
MIM : | 602007 |
Uniprot ID : | P46109 |
Chromosome Location : | 22q11.21 |
Pathway : | B Cell Receptor Signaling Pathway, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; |
Function : | SH3/SH2 adaptor activity; protein binding; protein tyrosine kinase activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
CRKL-561H | Recombinant Human CRKL Protein, His-tagged | +Inquiry |
CRKL-3324H | Recombinant Human CRKL Protein, MYC/DDK-tagged | +Inquiry |
CRKL-0644H | Recombinant Human CRKL Protein (M1-E303), Tag Free | +Inquiry |
CRKL-1889H | Recombinant Human CRKL Protein, GST-tagged | +Inquiry |
CRKL-1261R | Recombinant Rat CRKL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CRKL-403HCL | Recombinant Human CRKL cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket