Recombinant Human CRKL, His-tagged
| Cat.No. : | CRKL-26624TH |
| Product Overview : | Recombinant full length Human CrkL with an N terminal His tag; 323 amino acids with tag, predicted MWt 35.9 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 303 amino acids |
| Description : | This gene encodes a protein kinase containing SH2 and SH3 (src homology) domains which has been shown to activate the RAS and JUN kinase signaling pathways and transform fibroblasts in a RAS-dependent fashion. It is a substrate of the BCR-ABL tyrosine kinase, plays a role in fibroblast transformation by BCR-ABL, and may be oncogenic. |
| Conjugation : | HIS |
| Molecular Weight : | 35.900kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.03% DTT, 0.58% Sodium chloride |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSSARFDSSDRSAWYMGPVS RQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIE PAPRYPSPPMGSVSAPNLPTAEDNLEYVRTLYDFPGNDAE DLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVS GSPGAAITPLPSTQNGPVFAKAIQKRVPCAYDKTALALEV GDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD ENE |
| Sequence Similarities : | Belongs to the CRK family.Contains 1 SH2 domain.Contains 2 SH3 domains. |
| Gene Name | CRKL v-crk sarcoma virus CT10 oncogene homolog (avian)-like [ Homo sapiens ] |
| Official Symbol | CRKL |
| Synonyms | CRKL; v-crk sarcoma virus CT10 oncogene homolog (avian)-like; v crk avian sarcoma virus CT10 oncogene homolog like; crk-like protein; |
| Gene ID | 1399 |
| mRNA Refseq | NM_005207 |
| Protein Refseq | NP_005198 |
| MIM | 602007 |
| Uniprot ID | P46109 |
| Chromosome Location | 22q11.21 |
| Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; |
| Function | SH3/SH2 adaptor activity; protein binding; protein tyrosine kinase activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| CRKL-561H | Recombinant Human CRKL Protein, His-tagged | +Inquiry |
| CRKL-1889H | Recombinant Human CRKL Protein, GST-tagged | +Inquiry |
| CRKL-26624TH | Recombinant Human CRKL, His-tagged | +Inquiry |
| CRKL-1261R | Recombinant Rat CRKL Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRKL-571H | Recombinant Human CRKL | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRKL-403HCL | Recombinant Human CRKL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRKL Products
Required fields are marked with *
My Review for All CRKL Products
Required fields are marked with *
