Recombinant Human CRP protein, His-tagged
| Cat.No. : | CRP-4021H |
| Product Overview : | Recombinant Human CRP protein(1-91 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-91 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CRP C-reactive protein, pentraxin-related [ Homo sapiens ] |
| Official Symbol | CRP |
| Synonyms | CRP; C-reactive protein, pentraxin-related; C-reactive protein; pentraxin 1; PTX1; MGC88244; MGC149895; |
| Gene ID | 1401 |
| mRNA Refseq | NM_000567 |
| Protein Refseq | NP_000558 |
| MIM | 123260 |
| UniProt ID | P02741 |
| ◆ Recombinant Proteins | ||
| CRP-1741S | Recombinant Sheep CRP Protein, His-tagged | +Inquiry |
| CRP-008H | Recombinant Human CRP Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CRP-005B | Recombinant Bovine C reactive Protein, His tagged | +Inquiry |
| Crp-231R | Active Recombinant Rat Crp protein, His-tagged | +Inquiry |
| CRP-4021H | Recombinant Human CRP protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
| CRP-5330H | Native Canine CRP protein | +Inquiry |
| CRP-8059R | Native Rat Serum C-Reactive Protein | +Inquiry |
| CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
| CRP-5299H | Native Human C-Reactive Protein, Pentraxin-Related | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRP-2292MCL | Recombinant Mouse CRP cell lysate | +Inquiry |
| CRP-1165HCL | Recombinant Human CRP cell lysate | +Inquiry |
| CRP-1945RCL | Recombinant Rat CRP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRP Products
Required fields are marked with *
My Review for All CRP Products
Required fields are marked with *
