Recombinant Human CRP protein, His-tagged
Cat.No. : | CRP-4021H |
Product Overview : | Recombinant Human CRP protein(1-91 aa), fused to His tag, was expressed in E. coli. |
Availability | June 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-91 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CRP C-reactive protein, pentraxin-related [ Homo sapiens ] |
Official Symbol | CRP |
Synonyms | CRP; C-reactive protein, pentraxin-related; C-reactive protein; pentraxin 1; PTX1; MGC88244; MGC149895; |
Gene ID | 1401 |
mRNA Refseq | NM_000567 |
Protein Refseq | NP_000558 |
MIM | 123260 |
UniProt ID | P02741 |
◆ Recombinant Proteins | ||
CRP-1904H | Recombinant Human CRP Protein, GST-tagged | +Inquiry |
CRP-26069TH | Recombinant Human CRP | +Inquiry |
CRP-725HFL | Recombinant Full Length Human CRP Protein, C-Flag-tagged | +Inquiry |
CRP-1813H | Recombinant Human CRP Protein (Gln19-Pro224), C-His tagged | +Inquiry |
CRP-1814H | Recombinant Human CRP Protein (Gln19-Pro224), N-His tagged | +Inquiry |
◆ Native Proteins | ||
CRP-159M | Native Rhesus Monkey C-Reactive Protein | +Inquiry |
CRP-8057H | Native C-Reactive Protein | +Inquiry |
CRP-59C | Native Canine C-Reactive Protein | +Inquiry |
CRP-8374H | Native Human CRP | +Inquiry |
CRP-5330H | Native Canine CRP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRP-1945RCL | Recombinant Rat CRP cell lysate | +Inquiry |
CRP-1165HCL | Recombinant Human CRP cell lysate | +Inquiry |
CRP-2292MCL | Recombinant Mouse CRP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRP Products
Required fields are marked with *
My Review for All CRP Products
Required fields are marked with *
0
Inquiry Basket