Recombinant Human CRTC2 protein, His-tagged
Cat.No. : | CRTC2-11593H |
Product Overview : | Recombinant Human CRTC2 protein is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag. |
Availability | September 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 394-693 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH7.0). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | APALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ |
Purity : | > 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
Storage : | Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | CRTC2 CREB regulated transcription coactivator 2 [ Homo sapiens ] |
Official Symbol | CRTC2 |
Synonyms | CRTC2; CREB regulated transcription coactivator 2; TORC2; TORC-2; |
Gene ID | 200186 |
mRNA Refseq | NM_181715 |
Protein Refseq | NP_859066 |
MIM | 608972 |
UniProt ID | Q53ET0 |
◆ Recombinant Proteins | ||
CRTC2-2739H | Recombinant Human CRTC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRTC2-860R | Recombinant Rhesus Macaque CRTC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRTC2-01C | Recombinant Human CRTC2 Protein, GST tagged | +Inquiry |
CRTC2-1918H | Recombinant Human CRTC2 Protein, GST-tagged | +Inquiry |
CRTC2-2123HF | Recombinant Full Length Human CRTC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRTC2-7271HCL | Recombinant Human CRTC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRTC2 Products
Required fields are marked with *
My Review for All CRTC2 Products
Required fields are marked with *