Recombinant Human CRTC2 protein, His-tagged

Cat.No. : CRTC2-11593H
Product Overview : Recombinant Human CRTC2 protein is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag.
Availability April 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 394-693 aa
Form : The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH7.0). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : APALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ
Purity : > 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Samples are stable for up to twelve months from date of receipt at -70 centigrade.
Storage : Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name CRTC2 CREB regulated transcription coactivator 2 [ Homo sapiens ]
Official Symbol CRTC2
Synonyms CRTC2; CREB regulated transcription coactivator 2; TORC2; TORC-2;
Gene ID 200186
mRNA Refseq NM_181715
Protein Refseq NP_859066
MIM 608972
UniProt ID Q53ET0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CRTC2 Products

Required fields are marked with *

My Review for All CRTC2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon