| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
394-693 aa |
| Form : |
The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH7.0). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : |
APALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ |
| Purity : |
> 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : |
Samples are stable for up to twelve months from date of receipt at -70 centigrade. |
| Storage : |
Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : |
It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4℃ before opening to recover the entire contents. |
| Shipping : |
The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |