Recombinant Human CRX Protein, His-tagged
Cat.No. : | CRX-001H |
Product Overview : | Recombinant Human CRX Protein, His-tagged,expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 166-299 aa |
Tag : | C-His |
Molecular Mass : | 15 kDa |
AA Sequence : | MASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQILHHHHHHHH |
Purity : | >80% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1mg/ml by BCA |
Storage Buffer : | Sterile PBS, pH 7.4, 10% Glycerol, 5% Trehalose |
GeneID : | 1406 |
Gene Name | CRX cone-rod homeobox [ Homo sapiens (human) ] |
Official Symbol | CRX |
Synonyms | CRX; cone-rod homeobox; CORD2; cone-rod homeobox protein; CRD; LCA7; orthodenticle homeobox 3; OTX3 |
mRNA Refseq | NM_000554 |
Protein Refseq | NP_000545 |
MIM | 602225 |
UniProt ID | O43186 |
◆ Recombinant Proteins | ||
CRX-93HF | Recombinant Full Length Human CRX Protein | +Inquiry |
CRX-26343TH | Recombinant Human CRX | +Inquiry |
CRX-1919H | Recombinant Human CRX Protein, GST-tagged | +Inquiry |
CRX-3854H | Recombinant Human CRX protein, His-tagged | +Inquiry |
CRX-26342TH | Recombinant Human CRX | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRX-7270HCL | Recombinant Human CRX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRX Products
Required fields are marked with *
My Review for All CRX Products
Required fields are marked with *