Recombinant Human CRX Protein, His-tagged

• Cat.No.: CRX-001H
• Product Overview: Recombinant Human CRX Protein, His-tagged,expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 166-299 aa
• Tag: C-His
• Molecular Mass: 15 kDa
• AA Sequence: MASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPQLGGPALSPLSGPSVGPSLAQSPTSLSGQSYGAYSPVDSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQILHHHHHHHH
• Purity: >80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1mg/ml by BCA
• Storage Buffer: Sterile PBS, pH 7.4, 10% Glycerol, 5% Trehalose
• GeneID: 1406

Gene Information

• Gene Name: CRX cone-rod homeobox [ Homo sapiens (human) ]
• Official Symbol: CRX
• Synonyms: CRX; cone-rod homeobox; CORD2; cone-rod homeobox protein; CRD; LCA7; orthodenticle homeobox 3; OTX3
• mRNA Refseq: NM_000554
• Protein Refseq: NP_000545
• MIM: 602225
• UniProt ID: O43186