Recombinant Human CRYGB protein, His-tagged

• Cat.No.: CRYGB-2735H
• Product Overview: Recombinant Human CRYGB protein(P07316)(1-175aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-175aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.9 kDa
• AA Sequence: MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CRYGB crystallin, gamma B [ Homo sapiens ]
• Official Symbol: CRYGB
• Synonyms: CRGB_HUMAN; Crygb; Gamma-B-crystallin; Gamma-crystallin 1-2; Gamma-crystallin B; crystallin, gamma B; Gamma-crystallin 1-2; CRYGB
• Gene ID: 1419
• mRNA Refseq: NM_005210.3
• Protein Refseq: NP_005201.2
• MIM: 123670
• UniProt ID: P07316