Recombinant Human CRYGB protein, His-tagged
Cat.No. : | CRYGB-2735H |
Product Overview : | Recombinant Human CRYGB protein(P07316)(1-175aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-175aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | MGKITFYEDRAFQGRSYECTTDCPNLQPYFSRCNSIRVESGCWMIYERPNYQGHQYFLRRGEYPDYQQWMGLSDSIRSCCLIPPHSGAYRMKIYDRDELRGQMSELTDDCISVQDRFHLTEIHSLNVLEGSWILYEMPNYRGRQYLLRPGEYRRFLDWGAPNAKVGSLRRVMDLY |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CRYGB crystallin, gamma B [ Homo sapiens ] |
Official Symbol | CRYGB |
Synonyms | CRGB_HUMAN; Crygb; Gamma-B-crystallin; Gamma-crystallin 1-2; Gamma-crystallin B; crystallin, gamma B; Gamma-crystallin 1-2; CRYGB |
Gene ID | 1419 |
mRNA Refseq | NM_005210.3 |
Protein Refseq | NP_005201.2 |
MIM | 123670 |
UniProt ID | P07316 |
◆ Recombinant Proteins | ||
CRYGB-1043R | Recombinant Rhesus monkey CRYGB Protein, His-tagged | +Inquiry |
CRYGB-2735H | Recombinant Human CRYGB protein, His-tagged | +Inquiry |
CRYGB-1275R | Recombinant Rat CRYGB Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYGB-2001M | Recombinant Mouse CRYGB Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYGB-1938H | Recombinant Human CRYGB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYGB-7259HCL | Recombinant Human CRYGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYGB Products
Required fields are marked with *
My Review for All CRYGB Products
Required fields are marked with *