Recombinant Rat CRYGB Protein (2-175 aa), His-tagged
Cat.No. : | CRYGB-2228R |
Product Overview : | Recombinant Rat CRYGB Protein (2-175 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-175 aa |
Description : | Crystallins are the dominant structural components of the vertebrate eye lens. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 23.0 kDa |
AA Sequence : | GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Crygb crystallin, gamma B [ Rattus norvegicus (Norway rat) ] |
Official Symbol | CRYGB |
Synonyms | Crygb; Len; Cryg2; |
Gene ID | 301468 |
mRNA Refseq | NM_001109875 |
Protein Refseq | NP_001103345 |
UniProt ID | P10066 |
◆ Recombinant Proteins | ||
CRYGB-2735H | Recombinant Human CRYGB protein, His-tagged | +Inquiry |
CRYGB-2228R | Recombinant Rat CRYGB Protein (2-175 aa), His-tagged | +Inquiry |
CRYGB-2001M | Recombinant Mouse CRYGB Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYGB-868R | Recombinant Rhesus Macaque CRYGB Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYGB-3943M | Recombinant Mouse CRYGB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYGB-7259HCL | Recombinant Human CRYGB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRYGB Products
Required fields are marked with *
My Review for All CRYGB Products
Required fields are marked with *
0
Inquiry Basket