Recombinant Rat CRYGB Protein (2-175 aa), His-tagged

• Cat.No.: CRYGB-2228R
• Product Overview: Recombinant Rat CRYGB Protein (2-175 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein.

Specification

• Species: Rat
• Source: Yeast
• Tag: His
• Protein Length: 2-175 aa
• Description: Crystallins are the dominant structural components of the vertebrate eye lens.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 23.0 kDa
• AA Sequence: GKITFFEDRGFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWMLYERPNYQGHQYFLRRGDYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYERDDFRGQMSEITDDCLSLQDRFHLSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANAKVGSFRRVMDFY
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Crygb crystallin, gamma B [ Rattus norvegicus (Norway rat) ]
• Official Symbol: CRYGB
• Synonyms: Crygb; Len; Cryg2
• Gene ID: 301468
• mRNA Refseq: NM_001109875
• Protein Refseq: NP_001103345
• UniProt ID: P10066