Recombinant Human CSF2 Protein, Biotinylated
Cat.No. : | CSF2-492H |
Product Overview : | Biotinylated Recombinant human CSF2 protein was tag free. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 144 |
Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. This gene plays a role in promoting tissue inflammation. Elevated levels of cytokines, including the one produced by this gene, have been detected in SARS-CoV-2 infected patients that develop acute respiratory distress syndrome. Mice deficient in this gene or its receptor develop pulmonary alveolar proteinosis. |
Form : | Lyophilized |
AA Sequence : | MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens (human) ] |
Official Symbol | CSF2 |
Synonyms | CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897; |
Gene ID | 1437 |
mRNA Refseq | NM_000758 |
Protein Refseq | NP_000749 |
MIM | 138960 |
UniProt ID | P04141 |
◆ Recombinant Proteins | ||
CSF2-1968H | Active Recombinant Human CSF2 Protein | +Inquiry |
GM-CSF-368E | Recombinant Equine GM-CSF | +Inquiry |
CSF2-937H | Active Recombinant Human CSF2 Protein | +Inquiry |
Csf2-7180M | Recombinant Mouse Csf2 Protein | +Inquiry |
CSF2-87H | Recombinant Human CSF2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF2 Products
Required fields are marked with *
My Review for All CSF2 Products
Required fields are marked with *
0
Inquiry Basket