Recombinant Human CSF3 protein
Cat.No. : | CSF3-223H |
Product Overview : | Recombinant Human CSF3 protein was expressed in Escherichia coli. |
Availability | June 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 174 |
Description : | Granulocyte colony stimulating factor (G-CSF) is a pleiotropic cytokine. It is mainly produced by monocytes and macrophages upon activation by endotoxin, TNF-α and IFN-γ. Besides, many other cell types can secreted this protein after LPS, IL-1 or TNF-α activation, which are fibroblasts, endothelial cells, astrocytes and bone marrow stromal cells. Various carcinoma cell lines and myeloblastic leukemia cells can express G-CSF constitutively. G-CSF is cytokine that acts in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. In addition it may function in some adhesion or recognition events at the cell surface. In humans, two distinct cDNA clones for G-CSF, encoding 207 and 204 amino acid (a.a.) precursor proteins, have been isolated. Both proteins have a 30 a.a. signal peptide and have identical amino acid sequences except for a three a.a. insertion (deletion) at the 35th a.a. residue from the N-terminus of the mature protein. Human G-CSF is 73 % identical at the amino acid level to murine G-CSF and the two proteins show species cross-reactivity. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 10mM sodium acetate buffer, containing 5 % trehalose, pH 4.0. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 18.7 kDa, a single non-glycosylated polypeptide chain containing 174 amino acids. |
AA Sequence : | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Endotoxin : | Less than 1 EU/μg of rHuG-CSF as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CSF3 |
Official Symbol | CSF3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33; |
Gene ID | 1440 |
mRNA Refseq | NM_000759 |
Protein Refseq | NP_000750 |
MIM | 138970 |
UniProt ID | P09919 |
◆ Recombinant Proteins | ||
CSF3-490H | Recombinant Human CSF3 Protein | +Inquiry |
Csf3-275M | Recombinant Mouse Csf3 protein | +Inquiry |
Csf3-046M | Active Recombinant Mouse Csf3 Protein | +Inquiry |
CSF3-26467TH | Recombinant Human CSF3 | +Inquiry |
CSF3-134H | Active Recombinant Human CSF3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
0
Inquiry Basket