Recombinant Human CSF3 protein(41-200 aa), N-MBP & C-His-tagged
Cat.No. : | CSF3-2616H |
Product Overview : | Recombinant Human CSF3 protein(P09919)(41-200 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&MBP |
Protein Length : | 41-200 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 61.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV |
Gene Name | CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ] |
Official Symbol | CSF3 |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33 , G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33; |
Gene ID | 1440 |
mRNA Refseq | NM_000759 |
Protein Refseq | NP_000750 |
MIM | 138970 |
UniProt ID | P09919 |
◆ Recombinant Proteins | ||
Csf3-2014M | Recombinant Mouse Csf3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Csf3-100M | Recombinant Mouse Csf3 protein | +Inquiry |
CSF3-2742D | Recombinant Dog CSF3 protein, His-SUMO-tagged | +Inquiry |
CSF3-7741H | Recombinant Human CSF3 protein | +Inquiry |
Csf3-048M | Recombinant Mouse Csf3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
0
Inquiry Basket