Recombinant Human CSF3R Protein, GST-tagged

Cat.No. : CSF3R-1975H
Product Overview : Human CSF3R partial ORF ( AAH53585, 25 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Alternatively spliced transcript variants have been described. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia. [provided by RefSeq, Aug 2010]
Molecular Mass : 37.84 kDa
AA Sequence : ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSF3R colony stimulating factor 3 receptor (granulocyte) [ Homo sapiens ]
Official Symbol CSF3R
Synonyms CSF3R; colony stimulating factor 3 receptor (granulocyte); CD114; granulocyte colony-stimulating factor receptor; GCSFR; G-CSF-R; CD114 antigen; G-CSF receptor;
Gene ID 1441
mRNA Refseq NM_000760
Protein Refseq NP_000751
MIM 138971
UniProt ID Q99062

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSF3R Products

Required fields are marked with *

My Review for All CSF3R Products

Required fields are marked with *

0
cart-icon