Recombinant Human CSH1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CSH1-5313H
Product Overview : CSH1 MS Standard C13 and N15-labeled recombinant protein (NP_001308) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome.
Molecular Mass : 25 kDa
AA Sequence : MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CSH1 chorionic somatomammotropin hormone 1 [ Homo sapiens (human) ]
Official Symbol CSH1
Synonyms CSH1; chorionic somatomammotropin hormone 1 (placental lactogen); chorionic somatomammotropin hormone; choriomammotropin; chorionic somatomammotropin A; CSA; CSMT; FLJ75407; hCS A; PL; placental lactogen; CS-1; hCS-A;
Gene ID 1442
mRNA Refseq NM_001317
Protein Refseq NP_001308
MIM 150200
UniProt ID P01243

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSH1 Products

Required fields are marked with *

My Review for All CSH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon