"CSTA" Related Products

Expand

Recombinant Human CSTA Protein, GST-tagged

Cat.No. : CSTA-2037H
Product Overview : Human CSTA full-length ORF ( AAH10379, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. [provided by RefSeq, Jul 2008]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 36.52 kDa
AA Sequence : MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing: :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : CSTA cystatin A [ Homo sapiens (human) ]
Official Symbol : CSTA
Synonyms : CSTA; cystatin A; Cystatin A; Cystatin A (Stefin A); STF1; STFA; Cystatin AS; Cystatin-AS; Cystatin-A; Stefin A; Stefin-A; AREI; PSS4; cystatin-A; cystatin A (stefin A); cystatin AS
Gene ID : 1475
mRNA Refseq : NM_005213
Protein Refseq : NP_005204
MIM : 184600
UniProt ID : P01040

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.