Recombinant Human CSTA Protein, GST-tagged

Cat.No. : CSTA-2037H
Product Overview : Human CSTA full-length ORF ( AAH10379, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.52 kDa
AA Sequence : MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CSTA cystatin A [ Homo sapiens (human) ]
Official Symbol CSTA
Synonyms CSTA; cystatin A; Cystatin A; Cystatin A (Stefin A); STF1; STFA; Cystatin AS; Cystatin-AS; Cystatin-A; Stefin A; Stefin-A; AREI; PSS4; cystatin-A; cystatin A (stefin A); cystatin AS
Gene ID 1475
mRNA Refseq NM_005213
Protein Refseq NP_005204
MIM 184600
UniProt ID P01040

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSTA Products

Required fields are marked with *

My Review for All CSTA Products

Required fields are marked with *

0
cart-icon
0
compare icon