Recombinant Human CSTA Protein, GST-tagged
| Cat.No. : | CSTA-2037H |
| Product Overview : | Human CSTA full-length ORF ( AAH10379, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins, and kininogens. This gene encodes a stefin that functions as a cysteine protease inhibitor, forming tight complexes with papain and the cathepsins B, H, and L. The protein is one of the precursor proteins of cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. Stefins have been proposed as prognostic and diagnostic tools for cancer. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CSTA cystatin A [ Homo sapiens (human) ] |
| Official Symbol | CSTA |
| Synonyms | CSTA; cystatin A; Cystatin A; Cystatin A (Stefin A); STF1; STFA; Cystatin AS; Cystatin-AS; Cystatin-A; Stefin A; Stefin-A; AREI; PSS4; cystatin-A; cystatin A (stefin A); cystatin AS |
| Gene ID | 1475 |
| mRNA Refseq | NM_005213 |
| Protein Refseq | NP_005204 |
| MIM | 184600 |
| UniProt ID | P01040 |
| ◆ Recombinant Proteins | ||
| CSTA-2245HF | Recombinant Full Length Human CSTA Protein, GST-tagged | +Inquiry |
| CSTA-28192TH | Recombinant Human CSTA | +Inquiry |
| CSTA-3688H | Recombinant Human CSTA protein, GST-tagged | +Inquiry |
| CSTA-1861H | Recombinant Human CSTA Protein (Met1-Phe98), N-His tagged | +Inquiry |
| Csta-2672R | Recombinant Rat Csta protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSTA-7225HCL | Recombinant Human CSTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSTA Products
Required fields are marked with *
My Review for All CSTA Products
Required fields are marked with *
