Recombinant Human CTGF protein, His-tagged
Cat.No. : | CTGF-2554H |
Product Overview : | Recombinant Human CTGF protein(80-156 aa), fused to His tag, was expressed in E. coli. |
Availability | July 26, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 80-156 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CTGF connective tissue growth factor [ Homo sapiens ] |
Official Symbol | CTGF |
Synonyms | CTGF; connective tissue growth factor; CCN2; IGFBP8; IBP-8; IGFBP-8; CCN family member 2; IGF-binding protein 8; hypertrophic chondrocyte-specific protein 24; insulin-like growth factor-binding protein 8; NOV2; HCS24; MGC102839; |
Gene ID | 1490 |
mRNA Refseq | NM_001901 |
Protein Refseq | NP_001892 |
MIM | 121009 |
UniProt ID | P29279 |
◆ Recombinant Proteins | ||
CTGF-4047H | Recombinant Human CTGF Protein (Met1-Ala349), C-His tagged | +Inquiry |
CTGF-538C | Recombinant Cattle CTGF protein, His & T7-tagged | +Inquiry |
CTGF-543P | Recombinant Pig CTGF protein, His-tagged | +Inquiry |
CTGF-30H | Recombinant Human Connective Tissue Growth Factor, His-tagged | +Inquiry |
CTGF-542S | Recombinant Sheep CTGF protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTGF-7205HCL | Recombinant Human CTGF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTGF Products
Required fields are marked with *
My Review for All CTGF Products
Required fields are marked with *