Cat.No.:	Tnni3-1003H
Product Overview:	Recombinant Human cardiac troponin I antigen with a C-terminal histidine tag. Predicted molecular weight: 26 kDa.
Description:	Troponins form a complex of three regulatory proteins (troponin C, I and T) that are integral to muscle contraction in skeletal and cardiac muscles. Serum cardiac troponin tests can be used to help diagnose several different heart disorders, especially myocardial infarction.
Source:	E. coli
Species:	Human
Tag :	His
Form:	Lyophilized
Bio-activity:	Anti-h cTnI 9701: + Anti-h cTnI 9703: + Anti-h cTnI 9705: + Anti-h cTnI 9707: + Anti-h cTnI 9708: + Anti-h cTnI 9709: +
Molecular Mass:	26 kDa
AA Sequence:	MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED MEKENREVGDWRKNIDALSGMEGRKKKFESESSGGGSLEHHHHHHHH
Storage:	2–8centigrade
Concentration:	0.5 mg/ml when reconstituted with 200 µl of deionized water
Storage Buffer:	50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 8 M urea; containing 3 % sucrose, 2 % Dmannitol, and 0.01 % Tween 20 as stabilizers
Reconstitution:	Reconstitute the lyophilized protein with 200 µl of deionized water

Gene Name:	TNNI3 troponin I type 3 (cardiac) [ Homo sapiens ]
Official Symbol:	Tnni3
Synonyms:	TNNI3; troponin I type 3 (cardiac); troponin I, cardiac; troponin I, cardiac muscle; CMH7; TNNC1; RCM1; cTnI; CMD2A; CMD1FF; MGC116817;
Gene ID:	7137
mRNA Refseq:	NM_000363
Protein Refseq:	NP_000354
MIM:	191044
UniProt ID:	P19429

Online Inquiry