Recombinant Human CTNND2 Protein, GST-tagged

Cat.No. : CTNND2-2089H
Product Overview : Human CTNND2 partial ORF ( NP_001323, 1081 a.a. - 1190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an adhesive junction associated protein of the armadillo/beta-catenin superfamily and is implicated in brain and eye development and cancer formation. The protein encoded by this gene promotes the disruption of E-cadherin based adherens junction to favor cell spreading upon stimulation by hepatocyte growth factor. This gene is overexpressed in prostate adenocarcinomas and is associated with decreased expression of tumor suppressor E-cadherin in this tissue. This gene resides in a region of the short arm of chromosome 5 that is deleted in Cri du Chat syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2013]
Molecular Mass : 37.84 kDa
AA Sequence : ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTNND2 catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein) [ Homo sapiens ]
Official Symbol CTNND2
Synonyms CTNND2; catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein); catenin delta-2; GT24; NPRAP; neurojungin; T-cell delta-catenin;
Gene ID 1501
mRNA Refseq NM_001332
Protein Refseq NP_001323
MIM 604275
UniProt ID Q9UQB3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTNND2 Products

Required fields are marked with *

My Review for All CTNND2 Products

Required fields are marked with *

0
cart-icon
0
compare icon