Recombinant Human CTNND2 Protein, GST-tagged
Cat.No. : | CTNND2-2089H |
Product Overview : | Human CTNND2 partial ORF ( NP_001323, 1081 a.a. - 1190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an adhesive junction associated protein of the armadillo/beta-catenin superfamily and is implicated in brain and eye development and cancer formation. The protein encoded by this gene promotes the disruption of E-cadherin based adherens junction to favor cell spreading upon stimulation by hepatocyte growth factor. This gene is overexpressed in prostate adenocarcinomas and is associated with decreased expression of tumor suppressor E-cadherin in this tissue. This gene resides in a region of the short arm of chromosome 5 that is deleted in Cri du Chat syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2013] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRPPASEYTMHLG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTNND2 catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein) [ Homo sapiens ] |
Official Symbol | CTNND2 |
Synonyms | CTNND2; catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein); catenin delta-2; GT24; NPRAP; neurojungin; T-cell delta-catenin; |
Gene ID | 1501 |
mRNA Refseq | NM_001332 |
Protein Refseq | NP_001323 |
MIM | 604275 |
UniProt ID | Q9UQB3 |
◆ Recombinant Proteins | ||
CTNND2-3229H | Recombinant Human CTNND2 protein, His-tagged | +Inquiry |
CTNND2-2089H | Recombinant Human CTNND2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTNND2 Products
Required fields are marked with *
My Review for All CTNND2 Products
Required fields are marked with *
0
Inquiry Basket