Recombinant Human CTNND2 protein, His-tagged

Cat.No. : CTNND2-3229H
Product Overview : Recombinant Human CTNND2 protein(1043-1142 aa), fused to His tag, was expressed in E. coli.
Availability May 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1043-1142 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MIERDRQRPYSSSRTPSISPVRVSPNNRSASAPASPREMISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGAPAEDIKHNQVSA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name CTNND2 catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein) [ Homo sapiens ]
Official Symbol CTNND2
Synonyms CTNND2; catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein); catenin delta-2; GT24; NPRAP; neurojungin; T-cell delta-catenin;
Gene ID 1501
mRNA Refseq NM_001332
Protein Refseq NP_001323
MIM 604275
UniProt ID Q9UQB3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CTNND2 Products

Required fields are marked with *

My Review for All CTNND2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon