Recombinant Human CTSB, His-tagged
| Cat.No. : | CTSB-26410TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 125-339 of Human Cathepsin B with N terminal His tag; Predicted MWt 25 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 125-339 a.a. |
| Description : | The protein encoded by this gene is a lysosomal cysteine proteinase composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is also known as amyloid precursor protein secretase and is involved in the proteolytic processing of amyloid precursor protein (APP). Incomplete proteolytic processing of APP has been suggested to be a causative factor in Alzheimer disease, the most common cause of dementia. Overexpression of the encoded protein, which is a member of the peptidase C1 family, has been associated with esophageal adenocarcinoma and other tumors. At least five transcript variants encoding the same protein have been found for this gene. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 60 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTR KGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEG DTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIM AEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGH AIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI |
| Sequence Similarities : | Belongs to the peptidase C1 family. |
| Gene Name | CTSB cathepsin B [ Homo sapiens ] |
| Official Symbol | CTSB |
| Synonyms | CTSB; cathepsin B; |
| Gene ID | 1508 |
| mRNA Refseq | NM_001908 |
| Protein Refseq | NP_001899 |
| MIM | 116810 |
| Uniprot ID | P07858 |
| Chromosome Location | 8p23.1 |
| Pathway | Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; |
| Function | cysteine-type endopeptidase activity; kininogen binding; peptidase activity; peptide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| CTSB-279H | Recombinant Human CTSB protein, GST-tagged | +Inquiry |
| CTSB-416R | Recombinant Rhesus CTSB protein, His-tagged | +Inquiry |
| CTSB-278H | Recombinant Human CTSB, His tagged | +Inquiry |
| Ctsb-5635M | Recombinant Mouse Ctsb Protein (His18-Phe339), C-His tagged | +Inquiry |
| CTSB-1062B | Recombinant Branchiostoma belcheri tsingtauense CTSB Protein (Ala15-Asp332), C-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSB-26408TH | Native Human CTSB | +Inquiry |
| CTSB-1647H | Native Human Cathepsin B | +Inquiry |
| Ctsb-28M | Active Recombinant Mouse Ctsb Protein, His tagged | +Inquiry |
| CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
| CTSB-5328H | Native Human Cathepsin B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSB-335HKCL | Human CTSB Knockdown Cell Lysate | +Inquiry |
| CTSB-3025HCL | Recombinant Human CTSB cell lysate | +Inquiry |
| CTSB-1885MCL | Recombinant Mouse CTSB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSB Products
Required fields are marked with *
My Review for All CTSB Products
Required fields are marked with *
