Active Recombinant Mouse Ctsb Protein, His tagged
| Cat.No. : | Ctsb-28M |
| Product Overview : | Recombinant mouse CTSB (18-339 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 18-339 aa |
| Description : | CTSB, also known as cathepsin B preproprotein, is a papain-family cysteine protease that is normally located in lysosomes. It has the ability to degrade several extracellular matrix components at both neutral and acidic pH and has been implicated in the progression of several human and rodent tumors progression and arthritis. |
| Form : | Liquid |
| AASequence : | HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFLEHHHHHH |
| Molecular Mass : | 36.4 kDa (330aa) |
| Bio-activity : | Specific activity is > 2,000 pmol/min/μg and is defined as the amount of enzyme that hydrolyze 1 pmole of Z-Arg-Arg-AMC to Z-Arg-Arg and AMC per minute at pH 6.0 at 37 centigrade. |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 90% by SDS-PAGE |
| Application : | SDS-PAGE, Enzyme Activity |
| Storage : | Can be stored at +2C to +8C for 1 week. For long term storage, aliquot and store at -20C to -80C. Avoid repeated freezing and thawing cycles. |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
| Gene Name | Ctsb cathepsin B [ Mus musculus ] |
| Official Symbol | Ctsb |
| Synonyms | CTSB; cathepsin B; cathepsin B1; CB; |
| Gene ID | 13030 |
| mRNA Refseq | NM_007798 |
| Protein Refseq | NP_031824 |
| UniProt ID | P10605 |
| ◆ Recombinant Proteins | ||
| CTSB-26410TH | Recombinant Human CTSB, His-tagged | +Inquiry |
| CTSB-5644H | Recombinant Human CTSB protein, His-tagged | +Inquiry |
| Ctsb-415M | Active Recombinant Mouse Ctsb protein, His-tagged | +Inquiry |
| CTSB-911R | Recombinant Rhesus Macaque CTSB Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ctsb-8176M | Recombinant Mouse Ctsb protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSB-26408TH | Native Human CTSB | +Inquiry |
| CTSB-188B | Active Native Bovine Cathepsin B | +Inquiry |
| Ctsb-28M | Active Recombinant Mouse Ctsb Protein, His tagged | +Inquiry |
| CTSB-5328H | Native Human Cathepsin B | +Inquiry |
| CTSB-1647H | Native Human Cathepsin B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSB-1885MCL | Recombinant Mouse CTSB cell lysate | +Inquiry |
| CTSB-3025HCL | Recombinant Human CTSB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctsb Products
Required fields are marked with *
My Review for All Ctsb Products
Required fields are marked with *
