Active Recombinant Mouse Ctsb Protein, His tagged

Cat.No. : Ctsb-28M
Product Overview : Recombinant mouse CTSB (18-339 aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 18-339 aa
Description : CTSB, also known as cathepsin B preproprotein, is a papain-family cysteine protease that is normally located in lysosomes. It has the ability to degrade several extracellular matrix components at both neutral and acidic pH and has been implicated in the progression of several human and rodent tumors progression and arthritis.
Form : Liquid
AASequence : HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRFLEHHHHHH
Molecular Mass : 36.4 kDa (330aa)
Bio-activity : Specific activity is > 2,000 pmol/min/μg and is defined as the amount of enzyme that hydrolyze 1 pmole of Z-Arg-Arg-AMC to Z-Arg-Arg and AMC per minute at pH 6.0 at 37 centigrade.
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Application : SDS-PAGE, Enzyme Activity
Storage : Can be stored at +2C to +8C for 1 week. For long term storage, aliquot and store at -20C to -80C. Avoid repeated freezing and thawing cycles.
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Gene Name Ctsb cathepsin B [ Mus musculus ]
Official Symbol Ctsb
Synonyms CTSB; cathepsin B; cathepsin B1; CB;
Gene ID 13030
mRNA Refseq NM_007798
Protein Refseq NP_031824
UniProt ID P10605

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ctsb Products

Required fields are marked with *

My Review for All Ctsb Products

Required fields are marked with *

0
cart-icon
0
compare icon