Recombinant Human CTSO protein, His&Myc-tagged
| Cat.No. : | CTSO-2765H |
| Product Overview : | Recombinant Human CTSO protein(P43234)(108-321aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 108-321aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28.5 kDa |
| AA Sequence : | LPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTLNALNWLNKMQVKLVKDSEYPFKAQNGLCHYFSGSHSGFSIKGYSAYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTGSTPYWIVRNSWGSSWGVDGYAHVKMGSNVCGIADSVSSIFV |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CTSO cathepsin O [ Homo sapiens ] |
| Official Symbol | CTSO |
| Synonyms | CTSO; cathepsin O; CTSO1; |
| Gene ID | 1519 |
| mRNA Refseq | NM_001334 |
| Protein Refseq | NP_001325 |
| MIM | 600550 |
| UniProt ID | P43234 |
| ◆ Recombinant Proteins | ||
| CTSO-1103H | Recombinant Human CTSO protein, His & T7-tagged | +Inquiry |
| CTSO-2213H | Recombinant Human CTSO protein, MBP&His-tagged | +Inquiry |
| CTSO-5005H | Recombinant Human CTSO Protein, His-tagged | +Inquiry |
| CTSO-4059M | Recombinant Mouse CTSO Protein | +Inquiry |
| CTSO-2072M | Recombinant Mouse CTSO Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSO-7190HCL | Recombinant Human CTSO 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSO Products
Required fields are marked with *
My Review for All CTSO Products
Required fields are marked with *
