Recombinant Human CTSS protein, His-tagged
| Cat.No. : | CTSS-2766H |
| Product Overview : | Recombinant Human CTSS protein(P25774)(115-331aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 115-331aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 28 kDa |
| AA Sequence : | LPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEAQLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCGIASFPSYPEI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CTSS cathepsin S [ Homo sapiens ] |
| Official Symbol | CTSS |
| Synonyms | CTSS; cathepsin S; MGC3886; FLJ50259; |
| Gene ID | 1520 |
| mRNA Refseq | NM_001199739 |
| Protein Refseq | NP_001186668 |
| MIM | 116845 |
| UniProt ID | P25774 |
| ◆ Recombinant Proteins | ||
| Ctss-1985M | Recombinant Mouse Ctss protein, His-tagged | +Inquiry |
| CTSS-1893H | Recombinant Human CTSS Protein (Leu115-Ile331), His tagged | +Inquiry |
| Ctss-69M | Recombinant Mouse Ctss Protein, His-tagged | +Inquiry |
| Ctss-1113R | Recombinant Rat Ctss protein(Met1-Ile318), His-tagged | +Inquiry |
| CTSS-2363HF | Recombinant Full Length Human CTSS Protein, GST-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSS-27405TH | Native Human CTSS | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSS-3021HCL | Recombinant Human CTSS cell lysate | +Inquiry |
| CTSS-1563MCL | Recombinant Mouse CTSS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSS Products
Required fields are marked with *
My Review for All CTSS Products
Required fields are marked with *
