Recombinant Human CUL1 protein, His-tagged
| Cat.No. : | CUL1-2239H |
| Product Overview : | Recombinant Human CUL1 protein(363-533 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 363-533 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4, 17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | PKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDL |
| Gene Name | CUL1 cullin 1 [ Homo sapiens ] |
| Official Symbol | CUL1 |
| Synonyms | CUL1; cullin 1; cullin-1; CUL-1; MGC149834; MGC149835; |
| Gene ID | 8454 |
| mRNA Refseq | NM_003592 |
| Protein Refseq | NP_003583 |
| MIM | 603134 |
| UniProt ID | Q13616 |
| ◆ Recombinant Proteins | ||
| CUL1-2239H | Recombinant Human CUL1 protein, His-tagged | +Inquiry |
| CUL1-3189H | Recombinant Human CUL1 protein, His-tagged | +Inquiry |
| CUL1-1937HFL | Recombinant Full Length Human CUL1 Protein, C-Flag-tagged | +Inquiry |
| CUL1-11701H | Recombinant Human CUL1, GST-tagged | +Inquiry |
| CUL1-26258TH | Recombinant Human CUL1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CUL1-7185HCL | Recombinant Human CUL1 293 Cell Lysate | +Inquiry |
| CUL1-009HKCL | Human CUL1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUL1 Products
Required fields are marked with *
My Review for All CUL1 Products
Required fields are marked with *
