Recombinant Human CUL3 protein, GST-tagged
Cat.No. : | CUL3-322H |
Product Overview : | Recombinant Human CUL3 fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cullin protein family. The encoded protein plays a critical role in the polyubiquitination and subsequent degradation of specific protein substrates as the core component and scaffold protein of an E3 ubiquitin ligase complex. Complexes including the encoded protein may also play a role in late endosome maturation. Mutations in this gene are a cause of type 2E pseudohypoaldosteronism. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 115.3 kDa |
AA Sequence : | MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYT GLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYVQQNNVENVYNLGLIIFRDQ VVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFL AENSASVYIKKVEARINEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMY KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFE YFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDS EKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIP PAPRHAFEIFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMT ILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQ TVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIE REYLARTPEDRKVYTYVA |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CUL3 cullin 3 [ Homo sapiens ] |
Official Symbol | CUL3 |
Synonyms | CUL3; cullin 3; cullin-3; CUL-3; PHA2E; FLJ25665; |
Gene ID | 8452 |
mRNA Refseq | NM_003590 |
Protein Refseq | NP_003581 |
MIM | 603136 |
UniProt ID | Q13618 |
Chromosome Location | 2q36.2 |
Pathway | ATF-2 transcription factor network, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination and Proteasome degradation, organism-specific biosystem; Aurora B signaling, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; Class I MHC mediated antigen processing &. |
Function | cyclin binding; protein binding; ubiquitin protein ligase binding; contributes_to ubiquitin-protein ligase activity; |
◆ Recombinant Proteins | ||
CUL3-322H | Recombinant Human CUL3 protein, GST-tagged | +Inquiry |
CUL3-4077M | Recombinant Mouse Cul3 protein, His-tagged | +Inquiry |
CUL3-149H | Recombinant Human CUL3/Rbx1 Protein, GST-tagged | +Inquiry |
CUL3-756H | Recombinant Human CUL3 protein, His-tagged | +Inquiry |
CUL3-592HF | Recombinant Full Length Human CUL3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL3-7183HCL | Recombinant Human CUL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CUL3 Products
Required fields are marked with *
My Review for All CUL3 Products
Required fields are marked with *
0
Inquiry Basket