Recombinant Human CX3CL1 protein, His-SUMO-tagged
Cat.No. : | CX3CL1-2769H |
Product Overview : | Recombinant Human CX3CL1 protein(P78423)(25-100aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 25-100aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 24.6 kDa |
AA Sequence : | QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CX3CL1 chemokine (C-X3-C motif) ligand 1 [ Homo sapiens ] |
Official Symbol | CX3CL1 |
Synonyms | CX3CL1; chemokine (C-X3-C motif) ligand 1; SCYD1, small inducible cytokine subfamily D (Cys X3 Cys), member 1 (fractalkine, neurotactin); fractalkine; ABCD 3; C3Xkine; CXC3; CXC3C; neurotactin; NTN; C-X3-C motif chemokine 1; small-inducible cytokine D1; CX3C membrane-anchored chemokine; small inducible cytokine subfamily D (Cys-X3-Cys), member-1; small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin); NTT; SCYD1; ABCD-3; |
Gene ID | 6376 |
mRNA Refseq | NM_002996 |
Protein Refseq | NP_002987 |
MIM | 601880 |
UniProt ID | P78423 |
◆ Recombinant Proteins | ||
CX3CL1-051H | Active Recombinant Human CX3CL1 protein, His/Avi-tagged, Biotinylated | +Inquiry |
CX3CL1-482H | Recombinant Human CX3CL1 Protein | +Inquiry |
CX3CL1-926C | Recombinant Canine CX3CL1 Protein (Met1-Gly100), His-tagged | +Inquiry |
CX3CL1-4094M | Recombinant Mouse CX3CL1 Protein | +Inquiry |
CX3CL1-1342R | Recombinant Rat CX3CL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CX3CL1-3019HCL | Recombinant Human CX3CL1 cell lysate | +Inquiry |
CX3CL1-840CCL | Recombinant Canine CX3CL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CX3CL1 Products
Required fields are marked with *
My Review for All CX3CL1 Products
Required fields are marked with *
0
Inquiry Basket