Recombinant Human CX3CL1 protein, His-SUMO-tagged

Cat.No. : CX3CL1-2769H
Product Overview : Recombinant Human CX3CL1 protein(P78423)(25-100aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 25-100aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 24.6 kDa
AA Sequence : QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CX3CL1 chemokine (C-X3-C motif) ligand 1 [ Homo sapiens ]
Official Symbol CX3CL1
Synonyms CX3CL1; chemokine (C-X3-C motif) ligand 1; SCYD1, small inducible cytokine subfamily D (Cys X3 Cys), member 1 (fractalkine, neurotactin); fractalkine; ABCD 3; C3Xkine; CXC3; CXC3C; neurotactin; NTN; C-X3-C motif chemokine 1; small-inducible cytokine D1; CX3C membrane-anchored chemokine; small inducible cytokine subfamily D (Cys-X3-Cys), member-1; small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin); NTT; SCYD1; ABCD-3;
Gene ID 6376
mRNA Refseq NM_002996
Protein Refseq NP_002987
MIM 601880
UniProt ID P78423

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CX3CL1 Products

Required fields are marked with *

My Review for All CX3CL1 Products

Required fields are marked with *

0
cart-icon