Recombinant Human CX3CL1 protein, His-SUMO-tagged

• Cat.No.: CX3CL1-2769H
• Product Overview: Recombinant Human CX3CL1 protein(P78423)(25-100aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 25-100aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 24.6 kDa
• AA Sequence: QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CX3CL1 chemokine (C-X3-C motif) ligand 1 [ Homo sapiens ]
• Official Symbol: CX3CL1
• Synonyms: CX3CL1; chemokine (C-X3-C motif) ligand 1; SCYD1, small inducible cytokine subfamily D (Cys X3 Cys), member 1 (fractalkine, neurotactin); fractalkine; ABCD 3; C3Xkine; CXC3; CXC3C; neurotactin; NTN; C-X3-C motif chemokine 1; small-inducible cytokine D1; CX3C membrane-anchored chemokine; small inducible cytokine subfamily D (Cys-X3-Cys), member-1; small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin); NTT; SCYD1; ABCD-3
• Gene ID: 6376
• mRNA Refseq: NM_002996
• Protein Refseq: NP_002987
• MIM: 601880
• UniProt ID: P78423